- Recombinant Bacillus subtilis Uncharacterized protein ykoA (ykoA)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1147064
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 10,058 Da
- E Coli or Yeast
- 32509
- Uncharacterized protein ykoA (ykoA)
Sequence
MRLLTLTEYCLLIFFTGFYLAVTGFTAKDIGLYIGIALIYIFSHIFSKRLLEKRGKENKQVHLFFSVLAIIGSVFITVLCIALVASFSK